PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J610400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 275aa    MW: 30825.5 Da    PI: 9.9187
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J610400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-3150100151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Pavir.J610400.1.p  50 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 100
                        79***********************************************95 PP

2K-box97.32.3e-321172153100
              K-box   3 kssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                        +ss  s ++e + ++++qe+a+L+++i nLq+++R l+G++++++s+k+L+qLe +L+k+l kiR++Kne+l +++e++q++e elq++n +
  Pavir.J610400.1.p 117 NSSAAStVAEVTIQHYKQESARLRQQITNLQNSNRTLVGDSISTMSHKDLKQLEARLDKGLVKIRARKNEVLSSELEYMQRREMELQNDNLY 208
                        455555699999******************************************************************************** PP

              K-box  94 Lrkklee 100
                        Lr++++e
  Pavir.J610400.1.p 209 LRSRVDE 215
                        **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-4042101IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.22142102IPR002100Transcription factor, MADS-box
CDDcd002651.77E-4443116No hitNo description
SuperFamilySSF554552.88E-3343116IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004498IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-334464IPR002100Transcription factor, MADS-box
PfamPF003191.1E-265198IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-336479IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-3379100IPR002100Transcription factor, MADS-box
PfamPF014861.6E-24129213IPR002487Transcription factor, K-box
PROSITE profilePS5129714.261129219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
WGFSGQSTLT STTGPKLKEP AVSSPGSGSV GAAAAAAAAE KNGRGKIEIK RIENTTNRQV  60
TFCKRRNGLL KKAYELSVLC DAEVALIVFS SRGRLYEYSN NSVKATIERY KKATSDNSSA  120
ASTVAEVTIQ HYKQESARLR QQITNLQNSN RTLVGDSIST MSHKDLKQLE ARLDKGLVKI  180
RARKNEVLSS ELEYMQRREM ELQNDNLYLR SRVDENERAQ QTANMMGESS TSEYQQGFIP  240
YDPIRSFLQF NITQQQPQFY SQQEDRKDFN LGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-2043123282Myocyte-specific enhancer factor 2B
1tqe_Q2e-2043123282Myocyte-specific enhancer factor 2B
1tqe_R2e-2043123282Myocyte-specific enhancer factor 2B
1tqe_S2e-2043123282Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.420350.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEZAG1A0.0L18924.1 Corn ZAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.11e-180PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-129MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-158Q41876_MAIZE; Uncharacterized protein
STRINGSb09g006360.11e-158(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-93MIKC_MADS family protein